Organic Saposin A, Human, Recombinant Order Today [nQ2FA3wd]
Human lysosomes contain four homologous saposins (sphingolipid activator proteins), the saposins A, B, C, and D, which are derived from the prosaposin precursor protein (1, 2).Saposin A is small, cysteine-rich α-helical glycoprotein that exists in bo
Secure Shopping
100% Safe Guarantee
Free Shipping
On orders over $30
Money-Back
30-Day Guarantee
Organic Saposin A, Human, Recombinant Order Today [nQ2FA3wd]
Human lysosomes contain four homologous saposins (sphingolipid activator proteins), the saposins A, B, C, and D, which are derived from the prosaposin precursor protein (1, 2).
Saposin A is small, cysteine-rich α-helical glycoprotein that exists in both soluble and lipid-bound states. Saposin A has roles in sphingolipid catabolism and transport and is required for the breakdown of galactosylceramide by β-galactosylceramidase to produce ceramide and galactose (3).
Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays (2). Saposins are used as scaffolding proteins in a versatile lipid nanoparticle system to reconstitute membrane proteins in a lipid environment. Saposin-based nanoparticles may have a wide range of potential applications, from structural biology to the therapeutic delivery of protein-based pharmacological agents and vaccines (4).
Recombinant human saposin A is produced in E. coli as an N-terminal His-tag fusion and purified by proprietary chromatography techniques with subsequent removal of the tag trough a site-specific proteolytic cleavage.
Saposin A sequence
SMGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES
Catalog # SAPA-301
Storage buffer: 50 mM Tris-HCl, pH 7.5, 50 mM NaCl, and 50% Glycerol.
Concentration: 1.0 – 2.0 mg/mL by A280 (E1% 9.3).
Purity: >90% by Coomassie staining
Storage is recommended at -20°C for longer periods of time.
International Shipping: Product requires shipping on ice packs. Please contact [email protected] for shipment estimates
This product is for laboratory research use only.
Safety Data Sheet for Organic Saposin A, Human, Recombinant Order Today [nQ2FA3wd]
References
What Our Customers Say
Absolutely no complaints!
Very happy with the purchase.
- Juanita F..
Absolutely no complaints!
Simple, elegant, and functional.
- Eva D..
Absolutely no complaints!
Very happy with the quality.
- Vicki K..